PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02325.1.g00030.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 819aa    MW: 88909.8 Da    PI: 5.3329
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02325.1.g00030.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.8e-20202257156
                                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     +++ +++t +q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Zpz_sc02325.1.g00030.1.am.mkhc 202 KKRYHRHTLHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 257
                                     688899***********************************************998 PP

2START26.31.5e-09405478369
                                     HHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCG CS
                           START   3 aeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddk 69 
                                       +a++elv++a++++p+W       +++++e+ + f+ + +      ++ea+r+s+vv+m+   lve+l+d++
  Zpz_sc02325.1.g00030.1.am.mkhc 405 VVAAMDELVQMAQLDAPLWGMGTigGQLDEEEYARMFPGGIGprqydLRSEASRDSAVVIMTRDSLVEILMDTM 478
                                     6789***************99888*************88888******************************98 PP

3START46.97.8e-16493559140206
                                     TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 140 ssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                      s+  +   pS+ +  p + +   vtwvehv++++r++h+l+++lv+sgla+gak+wv tl+rqce+
  Zpz_sc02325.1.g00030.1.am.mkhc 493 ESYFSCLEVPSQAIWLPYPRNAQWVTWVEHVEVDDRSVHNLYKPLVNSGLAFGAKRWVGTLDRQCER 559
                                     5677788999999999***99999*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22184257IPR009057Homeodomain-like
SuperFamilySSF466891.63E-18189257IPR009057Homeodomain-like
PROSITE profilePS5007116.455199259IPR001356Homeobox domain
SMARTSM003892.8E-18200263IPR001356Homeobox domain
PfamPF000462.2E-17202257IPR001356Homeobox domain
CDDcd000862.18E-18202257No hitNo description
PROSITE patternPS000270234257IPR017970Homeobox, conserved site
SuperFamilySSF559611.03E-9395561No hitNo description
PfamPF018528.2E-5405478IPR002913START domain
PROSITE profilePS5084812.744484562IPR002913START domain
PfamPF018523.6E-11491559IPR002913START domain
SuperFamilySSF559611.28E-24581809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MPLHPSTLSA TPRLCGNNSA LPTRPGEAPE LDRIRDLSHA ILPSRLQIPF FSAGRRVEAG  60
IDQRYDLDLA PPPASFFHGP VALVRARTLA LDLLPRVSPA LPSSVMTPGR MIGRNGVAYG  120
SSSAMSLNQV DLLDSQHLQQ AFQQHLFDQI PAPTLDSGDN MIHGHADTLV DEFESKSCSE  180
NPDGTSGEDG QLEDPNQRPN KKKRYHRHTL HQIQEMEAFF KECPHPDDKQ RKELSRELGL  240
EPLQVKFWFQ NKRTQMKASA ITLDTLYYIA LNQHERQENA QLRAENDKLR SENMRCGGPA  300
ALGEMSFDEH HLRLENARLR DEIDRISGIA AKHVGKPMVS FPLLPSPLAA AAARSPLDLA  360
GAYGVQPPSL TADHIFGAGA GAGDLLRSVS TGHLDADKPM IVELVVAAMD ELVQMAQLDA  420
PLWGMGTIGG QLDEEEYARM FPGGIGPRQY DLRSEASRDS AVVIMTRDSL VEILMDTMSM  480
EFQVPSPLVP TRESYFSCLE VPSQAIWLPY PRNAQWVTWV EHVEVDDRSV HNLYKPLVNS  540
GLAFGAKRWV GTLDRQCERL ASAMASNIPN GDLGVITSIE GRKSMLKLAE RMVTSFCGGV  600
TASAAHQWTT LSGSGAEDVR VMTRKSVDDP GRPPGIVLNA ATSFWIPIPP KRVFDFLRDE  660
TSRSEWDILS NGGAVQEMAH IANGRDHGNC VSLLRVNSAN SNQSNMLILQ ESCTDASGSY  720
VVYAPVDVVA MNVVLNGGDP DYVALLPSGF AILPDGPPGA AAEGESPGGG SLLTVAFQIL  780
VDSVPTAKLS LGSVATVNSL IACTVERIKA AICGEGNLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972697.10.0PREDICTED: homeobox-leucine zipper protein ROC1-like
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLK3YGB70.0K3YGB7_SETIT; Uncharacterized protein
STRINGSi013285m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2